Description

Tesamorelin Research Peptide

Tesamorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) supplied for controlled laboratory research involving peptide-receptor interactions, endocrine signaling models, intracellular pathway analysis, and structure-function characterization.

This Tesamorelin research peptide is supplied in lyophilized powder form for laboratory, analytical, biochemical, and scientific research applications. Researchers evaluating Tesamorelin peptide can review the molecular information, sequence, physical form, storage specifications, research applications, and available batch documentation below.

Each batch is produced strictly for research-use-only applications and may be supported by batch-specific documentation through the RCHQ COA Library.

Tesamorelin is intended strictly for laboratory, analytical, and scientific research use only. It is not intended for human or animal consumption, medical use, diagnostic use, therapeutic use, dietary supplement use, cosmetic use, or compounding.

Tesamorelin Research Peptide Overview

Tesamorelin is a growth hormone-releasing hormone analog that can be studied in controlled laboratory models involving peptide-receptor interactions and endocrine signaling.

Research involving Tesamorelin may examine GHRH receptor interactions, intracellular signaling pathways, peptide structure, stability, degradation behavior, and structure-function relationships under defined experimental conditions.

For researchers comparing compounds within the broader research-peptide category, additional products are available through the Sio Peptide Vault peptide collection.

Researchers can also review related research compounds such as CJC-1295 + Ipamorelin when exploring different peptide structures and research areas.

Chemical Information

Tesamorelin Research Applications

Tesamorelin may be investigated in controlled laboratory environments for applications involving GHRH-derived peptide analogs and endocrine signaling models.

Potential Tesamorelin research applications include:

• GHRH receptor binding and signaling pathway analysis in isolated cell-based or cell-free in vitro assay systems
• Peptide-receptor interaction research involving endocrine signaling models
• Intracellular signaling cascade evaluation involving peptide ligands
• Structure-function research involving GHRH-derived peptide analogs
• Peptide stability and degradation profiling
• Analytical evaluation of peptide sequence and structural characteristics
• Comparative research involving synthetic peptide analogs

These applications refer exclusively to controlled laboratory research and do not represent medical or therapeutic uses.

All research involving Tesamorelin should be conducted by qualified professionals using appropriate laboratory practices, documentation, and controlled research conditions.

Tesamorelin Lyophilized Powder

Tesamorelin is supplied as a lyophilized research peptide.

The lyophilized format provides a dry form intended for laboratory storage, transportation, and handling. Researchers working with Tesamorelin should follow appropriate laboratory procedures and the documentation associated with the specific batch.

For additional laboratory materials, researchers can also view the Sio Peptide Vault solvent collection.

Tesamorelin Storage and Handling

Store lyophilized Tesamorelin according to appropriate laboratory storage practices.

The supplied product information specifies:

• Keep lyophilized material in a cool, dry environment.
• For long-term storage, maintain at -20°C / -4°F.
• Once reconstituted, store at 2–8°C / 36–46°F.
• Use promptly after reconstitution according to established laboratory protocols.
• Maintain appropriate aseptic handling practices.
• Avoid unnecessary repeated freeze-thaw cycles.
• Protect from unnecessary exposure to light, heat, and moisture.

Storage conditions may affect peptide stability. Researchers should follow their validated laboratory procedures and applicable batch documentation.

Tesamorelin Quality and COA Documentation

Tesamorelin batches may be supported by third-party analytical testing and batch-specific documentation.

Depending on the applicable batch documentation, testing may include verification of quality characteristics such as:

• Purity
• Compound identity
• Quantity verification
• Sterility
• Endotoxin levels

Researchers should consult the applicable Certificate of Analysis (COA) for the specific Tesamorelin batch when reviewing documented analytical results.

Batch-specific documentation should be used when evaluating an individual batch rather than assuming that analytical results are identical across different batches.

Tesamorelin Research Peptide Use Only

Tesamorelin is sold strictly for research use only.

This product is not intended for:

• Human consumption
• Animal consumption
• Medical use
• Diagnostic use
• Therapeutic use
• Dietary supplementation
• Cosmetic use
• Compounding

This product has not been evaluated or approved by the FDA for these uses. Buyers are responsible for determining and complying with applicable federal, state, and local requirements concerning research compounds.

By purchasing Tesamorelin, the buyer acknowledges that the product is intended only for lawful laboratory, analytical, biochemical, and scientific research by qualified individuals or institutions.

Frequently Asked Questions About Tesamorelin

What is Tesamorelin?

Tesamorelin is a synthetic growth hormone-releasing hormone (GHRH) analog supplied here as a research peptide for controlled laboratory investigation.

What is Tesamorelin used for in research?

Tesamorelin may be investigated in laboratory models involving GHRH receptor interactions, peptide-receptor binding, endocrine signaling pathways, intracellular signaling, peptide stability, and structure-function relationships.

What is the Tesamorelin peptide sequence?

The sequence listed for this research peptide is:

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

What is the molecular formula of Tesamorelin?

The listed molecular formula is C223H370N72O69S.

What is the molecular weight of Tesamorelin?

The listed molecular weight is 5195.9 g/mol.

What form is Tesamorelin supplied in?

Tesamorelin is supplied as a lyophilized powder for controlled laboratory research.

How should Tesamorelin be stored?

The supplied product information specifies -20°C / -4°F for long-term storage of lyophilized Tesamorelin and 2–8°C / 36–46°F after reconstitution.

Is batch documentation available for Tesamorelin?

Batch-specific documentation may be available. Researchers should review the applicable Certificate of Analysis (COA)for the individual Tesamorelin batch.

Is Tesamorelin intended for human use?

No. This product is supplied strictly for research use only and is not intended for human or animal consumption, medical, diagnostic, therapeutic, dietary supplement, cosmetic, or compounding use.