NAD+ — $109.99 $54.99 Shop Now

Semax — $59.99 $34.99 Shop Now

IGF-1 LR3 — $129.99 $49.99 Shop Now

RC-1S (SEMA) — $59.99 Shop Now

Cagrilintide — $119.99 $49.99 Shop Now

Search For Products


Sale!

IGF-1 LR3

$129.99 $49.99

Bulk Discount Quantity Price Per Vial
Save 20% 5 – 9 vials $39.99
Save 30% 10 – 19 vials $34.99
Save 40% 20 – 49 vials $29.99
Save 50% 50 + vials $25.00

Description

IGF-1 LR3 Research Peptide – Buy peptides online USA

Researchers searching for where to buy peptides online in the USA may encounter IGF-1 LR3 among specialized research peptide products. IGF-1 LR3 (Long Arg3 Insulin-like Growth Factor-1) is a synthetic peptide analog of human IGF-1 studied in controlled laboratory research involving peptide-receptor interactions, ligand binding, signaling pathways, and structure-function relationships.

IGF-1 LR3 contains a modification at position 3 and an extended sequence compared with native IGF-1, making it a useful research material for investigating modified peptide structure and receptor interactions under defined laboratory conditions. NAD+

This IGF-1 LR3 research peptide is supplied as a lyophilized powder and includes a 3 mL vial of 0.6% acetic acid buffer for compatible laboratory preparation. Batch-specific documentation may be available through the RCHQ COA Library.

IGF-1 LR3 is strictly for research use only. It is not intended for human or animal consumption, medical use, diagnostic use, therapeutic use, dietary supplementation, or compounding.

IGF-1 LR3 Research Peptide Overview

IGF-1 LR3 is a modified peptide analog used in controlled research environments to investigate molecular interactions and biochemical activity.

Chemical Information

  • Product Name: IGF-1 LR3
  • Full Name: Insulin-like Growth Factor-1 Long Arg3
  • Compound Type: Synthetic peptide analog
  • Molecular Formula: C400H625N111O115S9
  • Molecular Weight: 9117.53 g/mol
  • Sequence:MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Appearance: Lyophilized powder
  • Purity: Batch-specific; refer to applicable COA
  • Included Buffer: 3 mL of 0.6% acetic acid buffer
  • Intended Use: Laboratory and scientific research only

IGF-1 LR3 Research Applications

Researchers who buy peptides online in the USA for legitimate laboratory applications may investigate IGF-1 LR3 in areas such as:

  • IGF-1 receptor interaction research
  • Ligand-receptor binding studies
  • Signaling pathway analysis
  • Structure-function characterization
  • Modified peptide research
  • Peptide stability and degradation studies
  • Analytical evaluation of peptide structure and sequence

All research should be conducted by qualified professionals using appropriate laboratory practices and controlled experimental conditions.

IGF-1 LR3 Storage and Handling

Proper storage is important for maintaining the integrity of lyophilized research peptides.

General laboratory storage considerations include:

  • Store lyophilized material in a cool, dry environment
  • For long-term storage, maintain at -20°C / -4°F where appropriate
  • Following reconstitution, 2–8°C / 36–46°F may be appropriate according to laboratory protocols
  • Protect from unnecessary exposure to light, heat, and moisture
  • Avoid repeated freeze-thaw cycles
  • Follow appropriate laboratory handling procedures

Researchers should consult the applicable product documentation and internal laboratory protocols for compound-specific storage and handling requirements.

Quality Control and Testing

When deciding where to buy peptides online in the USA, researchers should consider product documentation, batch information, and available analytical testing.

IGF-1 LR3 batches may be supported by third-party testing and batch-specific documentation. Depending on the applicable testing package, analysis may include:

  • Purity
  • Peptide identity
  • Quantity verification
  • Sterility
  • Endotoxin testing

Researchers should review the applicable Certificate of Analysis (COA) for the specific batch before beginning laboratory research.

IGF-1 LR3 and Research Peptides

IGF-1 LR3 belongs to a broader category of synthetic research peptides used to investigate peptide structure, receptor interactions, and biochemical pathways.

Researchers comparing products when they buy peptides online in the USA should look beyond product names and evaluate:

  • Peptide identity
  • Amino-acid sequence
  • Purity information
  • Molecular weight
  • Batch-specific COA
  • Testing documentation
  • Storage requirements
  • Research-use restrictions

Accurate product documentation can help qualified researchers select appropriate materials for their laboratory work.

Frequently Asked Questions

What is IGF-1 LR3?

IGF-1 LR3 is a synthetic analog of IGF-1 studied in controlled laboratory research involving peptide-receptor interactions, ligand binding, and molecular signaling models.

Is IGF-1 LR3 a peptide?

Yes. IGF-1 LR3 is a synthetic peptide analog.

What does LR3 mean?

LR3 refers to Long Arg3, describing structural modifications to the IGF-1 peptide used in research.

Is IGF-1 LR3 intended for human use?

No. This product is supplied strictly for laboratory, analytical, and scientific research purposes and is not intended for human or animal consumption.

What should researchers look for when they buy peptides online in the USA?

Researchers should evaluate peptide identity, sequence, purity, batch-specific COA documentation, analytical testing, storage requirements, and applicable research-use restrictions.

Research-Use-Only Disclaimer

IGF-1 LR3 is sold strictly for research use only.

This product is not intended for human consumption, animal consumption, medical use, diagnostic use, therapeutic use, dietary supplementation, or compounding. Semax

This product has not been evaluated or approved by the FDA for these uses. Buyers are responsible for ensuring that purchasing, handling, and research involving this material comply with applicable federal, state, and local requirements.

For qualified laboratory, analytical, and scientific research purposes only.

Reviews

There are no reviews yet.

Be the first to review “IGF-1 LR3”

Your email address will not be published. Required fields are marked *

0
0
Your Cart
Empty CartYour cart is emptyReturn to Shop
Secure Checkout
Fast Shipping
Easy Returns